Loading...
Statistics
Advertisement

Monsieur-crepe.com

Advertisement
Conversion Technology Metas Server
Monsieur-crepe.com is hosted in Germany / Höst . Monsieur-crepe.com doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache/2.2.15 (Unix) mod_ssl/2.2.15 OpenSSL/0.9.8e-fips-rhel5 mod_fastcgi/2.4.6.

Technologies in use by Monsieur-crepe.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache/2.2.15 (Unix) mod_ssl/2.2.15 OpenSSL/0.9.8e-fips-rhel5 mod_fastcgi/2.4.6

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Monsieur-crepe.com

Missing HTTPS protocol.

    Meta - Monsieur-crepe.com

    Number of occurences: 4
    • Name: description
      Content:
    • Name: keywords
      Content:
    • Name: Content-Language
      Content: de
    • Name:
      Content: text/html; charset=iso-8859-1

    Server / Hosting

    • IP: 80.67.16.8
    • Latitude: 51.65
    • Longitude: 6.18
    • Country: Germany
    • City: Höst

    Rname

    • ns.namespace4you.de
    • ns2.namespace4you.de
    • mxlb.ispgateway.de

    Target

    • hostmaster.monsieur-crepe.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Sat, 23 Jul 2016 07:28:46 GMT Server: Apache/2.2.15 (Unix) mod_ssl/2.2.15 OpenSSL/0.9.8e-fips-rhel5 mod_fastcgi/2.4.6 Content-Type: text/html X-Cache: MISS from s_hp65 X-Cache-Lookup: MISS from s_hp65:80 Transfer-Encoding: chunked Via: 1.1 s_hp65 (squid/3.5.19) Connection: keep-alive

    DNS

    host: monsieur-crepe.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 80.67.16.8
    host: monsieur-crepe.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns.namespace4you.de
    host: monsieur-crepe.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns2.namespace4you.de
    host: monsieur-crepe.com
    1. class: IN
    2. ttl: 2560
    3. type: SOA
    4. mname: ns.namespace4you.de
    5. rname: hostmaster.monsieur-crepe.com
    6. serial: 1366707971
    7. refresh: 16384
    8. retry: 2048
    9. expire: 1048576
    10. minimum-ttl: 2560
    host: monsieur-crepe.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 100
    5. target: mxlb.ispgateway.de
    host: monsieur-crepe.com
    1. class: IN
    2. ttl: 3600
    3. type: AAAA
    4. ipv6: 2a00:1158::100:0:0:0:14

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.onsieur-crepe.com, www.mponsieur-crepe.com, www.ponsieur-crepe.com, www.moonsieur-crepe.com, www.oonsieur-crepe.com, www.mionsieur-crepe.com, www.ionsieur-crepe.com, www.mkonsieur-crepe.com, www.konsieur-crepe.com, www.m.onsieur-crepe.com, www..onsieur-crepe.com, www.muonsieur-crepe.com, www.uonsieur-crepe.com, www.mjonsieur-crepe.com, www.jonsieur-crepe.com, www.mnonsieur-crepe.com, www.nonsieur-crepe.com, www.m-onsieur-crepe.com, www.-onsieur-crepe.com, www.mnsieur-crepe.com, www.mobnsieur-crepe.com, www.mbnsieur-crepe.com, www.mohnsieur-crepe.com, www.mhnsieur-crepe.com, www.mognsieur-crepe.com, www.mgnsieur-crepe.com, www.mojnsieur-crepe.com, www.mjnsieur-crepe.com, www.momnsieur-crepe.com, www.mmnsieur-crepe.com, www.mo nsieur-crepe.com, www.m nsieur-crepe.com, www.movnsieur-crepe.com, www.mvnsieur-crepe.com, www.mosieur-crepe.com, www.monnsieur-crepe.com, www.monsieur-crepe.com, www.monhsieur-crepe.com, www.mohsieur-crepe.com, www.monjsieur-crepe.com, www.mojsieur-crepe.com, www.monksieur-crepe.com, www.moksieur-crepe.com, www.monlsieur-crepe.com, www.molsieur-crepe.com, www.mon sieur-crepe.com, www.mo sieur-crepe.com, www.monieur-crepe.com, www.monseieur-crepe.com, www.moneieur-crepe.com, www.monswieur-crepe.com, www.monwieur-crepe.com, www.monsdieur-crepe.com, www.mondieur-crepe.com, www.monsxieur-crepe.com, www.monxieur-crepe.com, www.monsfieur-crepe.com, www.monfieur-crepe.com, www.monsgieur-crepe.com, www.mongieur-crepe.com, www.monstieur-crepe.com, www.montieur-crepe.com, www.monseur-crepe.com, www.monsireur-crepe.com, www.monsreur-crepe.com, www.monsifeur-crepe.com, www.monsfeur-crepe.com, www.monsiveur-crepe.com, www.monsveur-crepe.com, www.monsikeur-crepe.com, www.monskeur-crepe.com, www.monsi,eur-crepe.com, www.mons,eur-crepe.com, www.monsibeur-crepe.com, www.monsbeur-crepe.com, www.monsigeur-crepe.com, www.monsgeur-crepe.com, www.monsiteur-crepe.com, www.monsteur-crepe.com, www.monsiyeur-crepe.com, www.monsyeur-crepe.com, www.monsiueur-crepe.com, www.monsueur-crepe.com, www.monsijeur-crepe.com, www.monsjeur-crepe.com, www.monsimeur-crepe.com, www.monsmeur-crepe.com, www.monsineur-crepe.com, www.monsneur-crepe.com, www.monsiur-crepe.com, www.monsiexur-crepe.com, www.monsixur-crepe.com, www.monsiesur-crepe.com, www.monsisur-crepe.com, www.monsiewur-crepe.com, www.monsiwur-crepe.com, www.monsierur-crepe.com, www.monsirur-crepe.com, www.monsiefur-crepe.com, www.monsifur-crepe.com, www.monsievur-crepe.com, www.monsivur-crepe.com, www.monsiecur-crepe.com, www.monsicur-crepe.com, www.monsiequr-crepe.com, www.monsiqur-crepe.com, www.monsieaur-crepe.com, www.monsiaur-crepe.com, www.monsieyur-crepe.com, www.monsiyur-crepe.com, www.monsier-crepe.com, www.monsieuwr-crepe.com, www.monsiewr-crepe.com, www.monsieuer-crepe.com, www.monsieer-crepe.com, www.monsieusr-crepe.com, www.monsiesr-crepe.com, www.monsieuar-crepe.com, www.monsiear-crepe.com, www.monsieu-crepe.com, www.monsieuri-crepe.com, www.monsieui-crepe.com, www.monsieuro-crepe.com, www.monsieuo-crepe.com, www.monsieurl-crepe.com, www.monsieul-crepe.com, www.monsieurl-crepe.com, www.monsieul-crepe.com, www.monsieur.-crepe.com, www.monsieu.-crepe.com, www.monsieurcrepe.com, www.monsieur-tcrepe.com, www.monsieurtcrepe.com, www.monsieur-gcrepe.com, www.monsieurgcrepe.com, www.monsieur-hcrepe.com, www.monsieurhcrepe.com, www.monsieur-ucrepe.com, www.monsieurucrepe.com, www.monsieur-jcrepe.com, www.monsieurjcrepe.com, www.monsieur-xcrepe.com, www.monsieurxcrepe.com, www.monsieur-screpe.com, www.monsieurscrepe.com, www.monsieur-acrepe.com, www.monsieuracrepe.com, www.monsieur-crepe.com, www.monsieurcrepe.com, www.monsieur- crepe.com, www.monsieur crepe.com, www.monsieur-repe.com, www.monsieur-cdrepe.com, www.monsieur-drepe.com, www.monsieur-crrepe.com, www.monsieur-rrepe.com, www.monsieur-ctrepe.com, www.monsieur-trepe.com, www.monsieur-cvrepe.com, www.monsieur-vrepe.com, www.monsieur-cfrepe.com, www.monsieur-frepe.com, www.monsieur-cgrepe.com, www.monsieur-grepe.com, www.monsieur-chrepe.com, www.monsieur-hrepe.com, www.monsieur-cnrepe.com, www.monsieur-nrepe.com, www.monsieur-cmrepe.com, www.monsieur-mrepe.com, www.monsieur-cjrepe.com, www.monsieur-jrepe.com,

    Other websites we recently analyzed

    1. Hamburg Pest Control - Exterminators, Pest Control, Pest Removal & Pest Management Services in Hamburg NY, Orchard Park NY and WNY
      San Francisco (United States) - 199.34.228.55
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Php, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 7
      Number of meta tags: 2
    2. pcg-b2p.space
      China - 103.232.215.140
      Server software: Tengine/1.4.2
      Technology: CloudFront, Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    3. Dokument nicht Gefunden!
      Germany - 213.135.0.4
      Server software: Apache
      Technology: Html
    4. RedT Homes - 19th Row II
      Scottsdale (United States) - 50.62.99.1
      G Analytics ID: UA-50126259-24
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, Google Analytics, Wordpress
      Number of Javascript: 24
      Number of meta tags: 2
    5. et-s.cn
      Kowloon (Hong Kong) - 123.1.149.57
      Server software: squid/3.5.12
      Technology: Html, Html5, Javascript
      Number of meta tags: 1
    6. vippscanadianpharmacyreviews.ru
      vippscanadianpharmacyreviews.ru
      Saint Louis (United States) - 69.64.32.180
      Server software: nginx/1.1.19
      Technology: Html
      Number of meta tags: 2
    7. Bob the BA - Business Analysis Training
      Business Analysis Training for Business Analysts Project Managers and Project Professionals
      New York (United States) - 198.185.159.145
      Server software: Protected by COMODO WAF mod_bwlimited/1.4
      Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Google Analytics, Squarespace
      Number of Javascript: 2
      Number of meta tags: 9
    8. 8997357.com
      Cheyenne (United States) - 23.224.74.159
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Html5, Javascript, SVG
      Number of Javascript: 13
      Number of meta tags: 5
    9. skagen-mtb.dk
      Copenhagen (Denmark) - 212.97.133.111
      Server software: Microsoft-IIS/7.0
      Technology: Html
      Number of meta tags: 1
    10. Manto Gallery
      New York (United States) - 198.49.23.145
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
      Number of Javascript: 3
      Number of meta tags: 7

    Check Other Websites